Lineage for d1buda_ (1bud A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) 
Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries) 
Domain d1buda_: 1bud A: [40328]
Details for d1buda_
PDB Entry: 1bud (more details), 1.9 Å
PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0
SCOP Domain Sequences for d1buda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buda_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiskenppciln
SCOP Domain Coordinates for d1buda_:
Click to download the PDB-style file with coordinates for d1buda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1buda_:
- d1buda_ appears in SCOP 1.57
- d1buda_ appears in the current release, SCOPe 2.08
View in 3D