Lineage for d1htdb_ (1htd B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135791Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 135792Protein Snake venom metalloprotease [55520] (4 species)
  7. 135803Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 135809Domain d1htdb_: 1htd B: [40327]

Details for d1htdb_

PDB Entry: 1htd (more details), 2.1 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)

SCOP Domain Sequences for d1htdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htdb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1htdb_:

Click to download the PDB-style file with coordinates for d1htdb_.
(The format of our PDB-style files is described here.)

Timeline for d1htdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1htda_