Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (22 PDB entries) |
Domain d7eova_: 7eov A: [403264] automated match to d1q1qa_ complexed with a3p, chd |
PDB Entry: 7eov (more details), 2.6 Å
SCOPe Domain Sequences for d7eova_:
Sequence, based on SEQRES records: (download)
>d7eova_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} deflwiegipfptvyysqeiirevrdrfvvrdedtiivtypksgthwlneivcliltkgd ptwvqstianertpwiefennyrilnskegprlmasllpiqlfpksffsskakviylirn prdvlvsgyhyfnalkqgkeqvpwkiyfenflqgksyfgswfehacgwislrkrenilvl syeqlkkdtrntikkiceflgenlesgelelvlknisfqimkermisqsclsniekhefi mrkgitgdwknhftvaqaeafdkafqekaadfpqelf
>d7eova_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} deflwiegipfptvyysqeiirevrdrfvvrdedtiivtypksgthwlneivcliltkgd ptwvqstianertpwiefennyrilnskegprlmasllpiqlfpksffsskakviylirn prdvlvsgyhyfnalkqgkeqvpwkiyfenflqgksyfgswfehacgwislrkrenilvl syeqlkkdtrntikkiceflgenlesgelelvlknisfqimkermislsniekhefimrk gitgdwknhftvaqaeafdkafqekaadfpqelf
Timeline for d7eova_: