Lineage for d1htda_ (1htd A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607714Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
    Pfam 01421
  6. 607719Protein Snake venom metalloprotease [55520] (7 species)
  7. 607739Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 607744Domain d1htda_: 1htd A: [40326]

Details for d1htda_

PDB Entry: 1htd (more details), 2.1 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (ht-d)

SCOP Domain Sequences for d1htda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htda_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1htda_:

Click to download the PDB-style file with coordinates for d1htda_.
(The format of our PDB-style files is described here.)

Timeline for d1htda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1htdb_