Lineage for d1dthb_ (1dth B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194670Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 194671Protein Snake venom metalloprotease [55520] (5 species)
  7. 194687Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 194691Domain d1dthb_: 1dth B: [40325]

Details for d1dthb_

PDB Entry: 1dth (more details), 2 Å

PDB Description: metalloprotease

SCOP Domain Sequences for d1dthb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dthb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1dthb_:

Click to download the PDB-style file with coordinates for d1dthb_.
(The format of our PDB-style files is described here.)

Timeline for d1dthb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dtha_