| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
| Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
| Protein Snake venom metalloprotease [55520] (7 species) |
| Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) |
| Domain d1dtha_: 1dth A: [40324] |
PDB Entry: 1dth (more details), 2 Å
SCOP Domain Sequences for d1dtha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtha_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
dsmhyyerflkqykpqcilnkp
Timeline for d1dtha_: