SCOPe 2.07: Domain d7edra1: 7edr A:11-97

Lineage for d7edra1 (7edr A:11-97)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255352] (2 PDB entries)

8. Domain d7edra1: 7edr A:11-97 [403236]
   Other proteins in same PDB: d7edra2, d7edra3, d7edrb2, d7edrb3
   automated match to d1gc7a3

Details for d7edra1

PDB Entry: 7edr, 2.53 Å

PDB Description: the crystal structure of the ferm and c-terminal domain complex of drosophila merlin

PDB Compounds: (A:) Moesin/ezrin/radixin homolog 2

SCOPe Domain Sequences for d7edra1:

Sequence; same for both SEQRES and ATOM records:

>d7edra1 d.15.1.0 (A:11-97) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
slsvrvstfdselefkleprasgqdlfdlvcrtiglreswyfglqyvdtrsnvswlkmek
rvrdqrvelhasnnvyvfsfyakffpe

Timeline for d7edra1:

• d7edra1 is new in SCOPe 2.07-stable
  
• d7edra1 appears in the current release, SCOPe 2.08