Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255352] (2 PDB entries) |
Domain d7edra1: 7edr A:11-97 [403236] Other proteins in same PDB: d7edra2, d7edra3, d7edrb2, d7edrb3 automated match to d1gc7a3 |
PDB Entry: 7edr (more details), 2.53 Å
SCOPe Domain Sequences for d7edra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edra1 d.15.1.0 (A:11-97) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} slsvrvstfdselefkleprasgqdlfdlvcrtiglreswyfglqyvdtrsnvswlkmek rvrdqrvelhasnnvyvfsfyakffpe
Timeline for d7edra1: