SCOP 1.67: Domain d1atlb_: 1atl B:

Lineage for d1atlb_ (1atl B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.9: Hemorrhagin [55519] (1 protein)

6. Protein Snake venom metalloprotease [55520] (6 species)

7. Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)

8. Domain d1atlb_: 1atl B: [40323]
   complexed with ca, ch3, sle, zn

Details for d1atlb_

PDB Entry: 1atl, 1.8 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)

SCOP Domain Sequences for d1atlb_:

Sequence; same for both SEQRES and ATOM records:

>d1atlb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

Timeline for d1atlb_:

• d1atlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1atlb_ appears in SCOP 1.65
  
• d1atlb_ appears in SCOP 1.69
  
• d1atlb_ appears in the current release, SCOPe 2.08