Lineage for d1atlb_ (1atl B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82295Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 82296Protein Snake venom metalloprotease [55520] (4 species)
  7. 82307Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. 82309Domain d1atlb_: 1atl B: [40323]

Details for d1atlb_

PDB Entry: 1atl (more details), 1.8 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)

SCOP Domain Sequences for d1atlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atlb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

SCOP Domain Coordinates for d1atlb_:

Click to download the PDB-style file with coordinates for d1atlb_.
(The format of our PDB-style files is described here.)

Timeline for d1atlb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1atla_