Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
Protein Snake venom metalloprotease [55520] (7 species) |
Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) |
Domain d1atlb_: 1atl B: [40323] complexed with 0qi, ca, zn |
PDB Entry: 1atl (more details), 1.8 Å
SCOPe Domain Sequences for d1atlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atlb_ d.92.1.9 (B:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]} lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds mhyyerflkqykpqcilnkp
Timeline for d1atlb_: