Lineage for d7d6rb_ (7d6r B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398212Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2398357Species Shigella dysenteriae, toxin II [TaxId:622] [101755] (3 PDB entries)
  8. 2398358Domain d7d6rb_: 7d6r B: [403221]
    Other proteins in same PDB: d7d6ra_
    automated match to d1r4pb_
    complexed with 1ps, nh2

Details for d7d6rb_

PDB Entry: 7d6r (more details), 1.6 Å

PDB Description: crystal structure of the stx2a complexed with mma betaala peptide
PDB Compounds: (B:) Shiga toxin 2 B subunit

SCOPe Domain Sequences for d7d6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d6rb_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin II [TaxId: 622]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnn

SCOPe Domain Coordinates for d7d6rb_:

Click to download the PDB-style file with coordinates for d7d6rb_.
(The format of our PDB-style files is described here.)

Timeline for d7d6rb_: