Lineage for d1atla_ (1atl A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries) 
Domain d1atla_: 1atl A: [40322]
Details for d1atla_
PDB Entry: 1atl (more details), 1.8 Å
PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)
SCOP Domain Sequences for d1atla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp
SCOP Domain Coordinates for d1atla_:
Click to download the PDB-style file with coordinates for d1atla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1atla_:
- d1atla_ appears in SCOP 1.57
- d1atla_ appears in the current release, SCOPe 2.08
View in 3D
