Lineage for d1atla_ (1atl A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. Protein Snake venom metalloprotease [55520] (7 species)
  7. Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)
  8. Domain d1atla_: 1atl A: [40322]
    complexed with 0qi, ca, zn

Details for d1atla_

PDB Entry: 1atl (more details), 1.8 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)
PDB Compounds: (A:) Snake venom metalloproteinase atrolysin-D

SCOPe Domain Sequences for d1atla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

SCOPe Domain Coordinates for d1atla_ are not available.

Timeline for d1atla_:

Domains from other chains:
(mouse over for more information)
d1atlb_