SCOPe 2.08: Domain d1atla_: 1atl A:

Lineage for d1atla_ (1atl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
   Pfam PF01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId:8730] [55522] (3 PDB entries)

8. Domain d1atla_: 1atl A: [40322]
   complexed with 0qi, ca, zn

Details for d1atla_

PDB Entry: 1atl, 1.8 Å

PDB Description: structural interaction of natural and synthetic inhibitors with the venom metalloproteinase, atrolysin c (form-d)

PDB Compounds: (A:) Snake venom metalloproteinase atrolysin-D

SCOPe Domain Sequences for d1atla_:

Sequence; same for both SEQRES and ATOM records:

>d1atla_ d.92.1.9 (A:) Snake venom metalloprotease {Western diamonback rattlesnake (Crotalus atrox), atrolysin C [TaxId: 8730]}
lpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiwsne
dqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpkls
igivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsdds
mhyyerflkqykpqcilnkp

Timeline for d1atla_:

• d1atla_ first appeared (with stable ids) in SCOP 1.55
  
• d1atla_ appears in SCOPe 2.07