SCOP 1.71: Domain d3aig__: 3aig -

Lineage for d3aig__ (3aig -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
   Pfam 01421

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)

8. Domain d3aig__: 3aig - [40321]
   complexed with ca, fle, so4, tcr, zn

Details for d3aig__

PDB Entry: 3aig, 2.8 Å

PDB Description: adamalysin ii with peptidomimetic inhibitor pol656

SCOP Domain Sequences for d3aig__:

Sequence; same for both SEQRES and ATOM records:

>d3aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

Timeline for d3aig__:

• d3aig__ first appeared (with stable ids) in SCOP 1.55
  
• d3aig__ appears in SCOP 1.69
  
• d3aig__ is called d3aiga_ in SCOP 1.73
  
• d3aig__ appears in the current release, SCOPe 2.08, called d3aiga_