Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
Protein Snake venom metalloprotease [55520] (6 species) |
Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) |
Domain d3aig__: 3aig - [40321] complexed with ca, fle, so4, tcr, zn |
PDB Entry: 3aig (more details), 2.8 Å
SCOP Domain Sequences for d3aig__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II} nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd smgyyqkflnqykpqcilnkp
Timeline for d3aig__: