Lineage for d3aig__ (3aig -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.9: Hemorrhagin [55519] (1 protein) Protein Snake venom metalloprotease [55520] (4 species) 
Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) 
Domain d3aig__: 3aig - [40321]
Details for d3aig__
PDB Entry: 3aig (more details), 2.8 Å
PDB Description: adamalysin ii with peptidomimetic inhibitor pol656
SCOP Domain Sequences for d3aig__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp
SCOP Domain Coordinates for d3aig__:
Click to download the PDB-style file with coordinates for d3aig__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3aig__:
- d3aig__ appears in SCOP 1.57
- d3aig__ appears in the current release, SCOPe 2.08, called d3aiga_
View in 3D