Lineage for d2aigp_ (2aig P:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 508036Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 508037Protein Snake venom metalloprotease [55520] (7 species)
  7. 508042Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)
  8. 508045Domain d2aigp_: 2aig P: [40320]

Details for d2aigp_

PDB Entry: 2aig (more details), 2.6 Å

PDB Description: adamalysin ii with peptidomimetic inhibitor pol647

SCOP Domain Sequences for d2aigp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aigp_ d.92.1.9 (P:) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

SCOP Domain Coordinates for d2aigp_:

Click to download the PDB-style file with coordinates for d2aigp_.
(The format of our PDB-style files is described here.)

Timeline for d2aigp_: