SCOP 1.65: Domain d2aigp_: 2aig P:

Lineage for d2aigp_ (2aig P:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.9: Hemorrhagin [55519] (1 protein)

6. Protein Snake venom metalloprotease [55520] (5 species)

7. Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)

8. Domain d2aigp_: 2aig P: [40320]
   complexed with ca, fle, so4, zn

Details for d2aigp_

PDB Entry: 2aig, 2.6 Å

PDB Description: adamalysin ii with peptidomimetic inhibitor pol647

SCOP Domain Sequences for d2aigp_:

Sequence; same for both SEQRES and ATOM records:

>d2aigp_ d.92.1.9 (P:) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

Timeline for d2aigp_:

• d2aigp_ first appeared (with stable ids) in SCOP 1.55
  
• d2aigp_ appears in SCOP 1.63
  
• d2aigp_ appears in SCOP 1.67
  
• d2aigp_ appears in the current release, SCOPe 2.08