| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
| Family d.92.1.9: Hemorrhagin [55519] (1 protein) |
| Protein Snake venom metalloprotease [55520] (5 species) |
| Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries) |
| Domain d4aig__: 4aig - [40318] complexed with ca, flx, zn |
PDB Entry: 4aig (more details), 2 Å
SCOP Domain Sequences for d4aig__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp
Timeline for d4aig__: