SCOP 1.65: Domain d4aig__: 4aig -

Lineage for d4aig__ (4aig -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.9: Hemorrhagin [55519] (1 protein)

6. Protein Snake venom metalloprotease [55520] (5 species)

7. Species Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II [TaxId:8729] [55521] (4 PDB entries)

8. Domain d4aig__: 4aig - [40318]
   complexed with ca, flx, zn

Details for d4aig__

PDB Entry: 4aig, 2 Å

PDB Description: adamalysin ii with phosphonate inhibitor

SCOP Domain Sequences for d4aig__:

Sequence; same for both SEQRES and ATOM records:

>d4aig__ d.92.1.9 (-) Snake venom metalloprotease {Eastern diamondback rattlesnake (Crotalus adamanteus), adamalysin II}
nlpqryielvvvadrrvfmkynsdlniirtrvheivniinefyrslnirvsltdleiwsg
qdfitiqssssntlnsfgewrervlltrkrhdnaqlltainfegkiigkaytssmcnprs
svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
smgyyqkflnqykpqcilnkp

Timeline for d4aig__:

• d4aig__ first appeared (with stable ids) in SCOP 1.55
  
• d4aig__ appears in SCOP 1.63
  
• d4aig__ appears in SCOP 1.67
  
• d4aig__ appears in the current release, SCOPe 2.08, called d4aiga_