SCOPe 2.07: Domain d7cbvb_: 7cbv B:

Lineage for d7cbvb_ (7cbv B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:655816] [341938] (5 PDB entries)

8. Domain d7cbvb_: 7cbv B: [403173]
   automated match to d5y8tb_

Details for d7cbvb_

PDB Entry: 7cbv, 2.3 Å

PDB Description: crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32)

PDB Compounds: (B:) PadR family transcriptional regulator

SCOPe Domain Sequences for d7cbvb_:

Sequence, based on SEQRES records:

>d7cbvb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrttiq
gtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdql
lkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswlesilamid

Sequence, based on observed residues (ATOM records):

>d7cbvb_ a.4.5.0 (B:) automated matches {Bacillus subtilis [TaxId: 655816]}
rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrkmyt
ltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkaklsdl
qgsyeklmapmsfsspdfghylvltkalereknyvswlesilamid

Timeline for d7cbvb_:

• d7cbvb_ is new in SCOPe 2.07-stable
  
• d7cbvb_ appears in the current release, SCOPe 2.08