SCOPe 2.08: Domain d7cjjl_: 7cjj l:

Lineage for d7cjjl_ (7cjj l:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)

8. Domain d7cjjl_: 7cjj l: [403156]
   Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_
   automated match to d3a0hl_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjl_

PDB Entry: 7cjj, 2.4 Å

PDB Description: photosystem ii structure in the s2 state

PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7cjjl_:

Sequence; same for both SEQRES and ATOM records:

>d7cjjl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d7cjjl_:

• d7cjjl_ first appeared in SCOPe 2.07