Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries) |
Domain d7bhsa2: 7bhs A:126-251 [403115] automated match to d2hj2a2 complexed with sam, tnz |
PDB Entry: 7bhs (more details), 1.05 Å
SCOPe Domain Sequences for d7bhsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bhsa2 d.130.1.0 (A:126-251) automated matches {Human (Homo sapiens) [TaxId: 9606]} needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq psgrfv
Timeline for d7bhsa2: