Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.8: Astacin [55516] (2 proteins) automatically mapped to Pfam PF01400 |
Protein Astacin [55517] (1 species) |
Species European fresh water crayfish (Astacus astacus) [TaxId:6715] [55518] (9 PDB entries) |
Domain d1iaea_: 1iae A: [40311] complexed with ni |
PDB Entry: 1iae (more details), 1.83 Å
SCOPe Domain Sequences for d1iaea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaea_ d.92.1.8 (A:) Astacin {European fresh water crayfish (Astacus astacus) [TaxId: 6715]} aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka hmlqtdanqinnlytnecsl
Timeline for d1iaea_: