SCOPe 2.08: Domain d7cjjt_: 7cjj t:

Lineage for d7cjjt_ (7cjj t:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family)
   automatically mapped to Pfam PF01405

5. Family f.23.34.1: PsbT-like [161030] (2 proteins)
   Pfam PF01405

6. Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (24 PDB entries)

8. Domain d7cjjt_: 7cjj t: [403109]
   Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjju_, d7cjjv_, d7cjjx_, d7cjjz_
   automated match to d2axtt1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjt_

PDB Entry: 7cjj, 2.4 Å

PDB Description: photosystem ii structure in the s2 state

PDB Compounds: (t:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d7cjjt_:

Sequence; same for both SEQRES and ATOM records:

>d7cjjt_ f.23.34.1 (t:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

Timeline for d7cjjt_:

• d7cjjt_ first appeared in SCOPe 2.07