Lineage for d1fqha_ (1fqh A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34380Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 34381Protein Botulinum neurotoxin [55513] (2 species)
  7. 34384Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (5 PDB entries)
  8. 34389Domain d1fqha_: 1fqh A: [40309]

Details for d1fqha_

PDB Entry: 1fqh (more details), 2.8 Å

PDB Description: botulinum neurotoxin type b catalytic domain with inhibitor bound

SCOP Domain Sequences for d1fqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqha_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype B}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeis

SCOP Domain Coordinates for d1fqha_:

Click to download the PDB-style file with coordinates for d1fqha_.
(The format of our PDB-style files is described here.)

Timeline for d1fqha_: