SCOPe 2.08: Domain d7c8pa_: 7c8p A:

Lineage for d7c8pa_ (7c8p A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries)

8. Domain d7c8pa_: 7c8p A: [403059]
   automated match to d2p3ka_

Details for d7c8pa_

PDB Entry: 7c8p, 2.6 Å

PDB Description: structural and functional characterization of human group a rotavirus p[25] vp8*

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d7c8pa_:

Sequence; same for both SEQRES and ATOM records:

>d7c8pa_ b.29.1.0 (A:) automated matches {Rotavirus a [TaxId: 28875]}
vldgpyqptsfnlpvdywmmmsptqagrvaegtngtdrwfaciivepnvslqsrdyvldg
qtvqlqvdntsntmwkfilfikltksgnysqysslltnhklcawikrdsrvywfdgtvpn
ssdnyyltinndnsivssdvdfyliprtqtdscrrcinngl

Timeline for d7c8pa_:

• d7c8pa_ first appeared in SCOPe 2.07