Lineage for d3btaa3 (3bta A:1-546)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415575Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 415576Protein Botulinum neurotoxin [55513] (2 species)
  7. 415577Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (2 PDB entries)
  8. 415580Domain d3btaa3: 3bta A:1-546 [40304]
    Other proteins in same PDB: d3btaa1, d3btaa2, d3btaa4
    complexed with zn

Details for d3btaa3

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a

SCOP Domain Sequences for d3btaa3:

Sequence, based on SEQRES records: (download)

>d3btaa3 d.92.1.7 (A:1-546) Botulinum neurotoxin {Clostridium botulinum, serotype A}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrgiitsktksldkgynkalndlcikvnnwdlffspsednftndlnkgeei
tsdtnieaaeenisldliqqyyltfnfdnepenisienlssdiigqlelmpnierfpngk
kyeldk

Sequence, based on observed residues (ATOM records): (download)

>d3btaa3 d.92.1.7 (A:1-546) Botulinum neurotoxin {Clostridium botulinum, serotype A}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrndlcikvnnwdlffspsednftndlnkgeeitsdtnieaaeenisldli
qqyyltfnfdnepenisienlssdiigqlelmpnierfpngkkyeldk

SCOP Domain Coordinates for d3btaa3:

Click to download the PDB-style file with coordinates for d3btaa3.
(The format of our PDB-style files is described here.)

Timeline for d3btaa3: