Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) Serralysin |
Domain d1af0a2: 1af0 A:2-246 [40301] Other proteins in same PDB: d1af0a1 complexed with 0z9, ca, zn |
PDB Entry: 1af0 (more details), 1.8 Å
SCOPe Domain Sequences for d1af0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af0a2 d.92.1.6 (A:2-246) Metalloprotease {Serratia marcescens [TaxId: 615]} attgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfs fpdykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnys qdrpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheigha lglshpgdynagegdptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaa iqhly
Timeline for d1af0a2: