![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) ![]() |
![]() | Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein) |
![]() | Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species) |
![]() | Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) |
![]() | Domain d1sat_2: 1sat 4-246 [40300] Other proteins in same PDB: d1sat_1 |
PDB Entry: 1sat (more details), 1.75 Å
SCOP Domain Sequences for d1sat_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sat_2 d.92.1.6 (4-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens} tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg lshpgdynagegdptyadvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq hly
Timeline for d1sat_2: