Lineage for d1sata2 (1sat A:4-246)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963971Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2963972Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2963996Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
    Serralysin
  8. 2963997Domain d1sata2: 1sat A:4-246 [40300]
    Other proteins in same PDB: d1sata1
    complexed with ca, zn

Details for d1sata2

PDB Entry: 1sat (more details), 1.75 Å

PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens
PDB Compounds: (A:) serratia protease

SCOPe Domain Sequences for d1sata2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sata2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegdptyadvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOPe Domain Coordinates for d1sata2:

Click to download the PDB-style file with coordinates for d1sata2.
(The format of our PDB-style files is described here.)

Timeline for d1sata2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sata1