Lineage for d1akla2 (1akl A:1-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205315Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2205316Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2205327Species Pseudomonas aeruginosa [TaxId:287] [55510] (3 PDB entries)
    alkaline protease
  8. 2205330Domain d1akla2: 1akl A:1-246 [40299]
    Other proteins in same PDB: d1akla1
    complexed with ca, zn

Details for d1akla2

PDB Entry: 1akl (more details), 2 Å

PDB Description: alkaline protease from pseudomonas aeruginosa ifo3080
PDB Compounds: (A:) alkaline protease

SCOPe Domain Sequences for d1akla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akla2 d.92.1.6 (A:1-246) Metalloprotease {Pseudomonas aeruginosa [TaxId: 287]}
grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
aiqkly

SCOPe Domain Coordinates for d1akla2:

Click to download the PDB-style file with coordinates for d1akla2.
(The format of our PDB-style files is described here.)

Timeline for d1akla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akla1