![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) ![]() |
![]() | Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
![]() | Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [55510] (3 PDB entries) alkaline protease |
![]() | Domain d1akl_2: 1akl 1-246 [40299] Other proteins in same PDB: d1akl_1 complexed with ca, zn |
PDB Entry: 1akl (more details), 2 Å
SCOP Domain Sequences for d1akl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akl_2 d.92.1.6 (1-246) Metalloprotease {Pseudomonas aeruginosa} grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia aiqkly
Timeline for d1akl_2: