Lineage for d1i1ip_ (1i1i P:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. Family d.92.1.5: Neurolysin (endopeptidase 24.16) [55505] (1 protein)
  6. Protein Neurolysin (endopeptidase 24.16) [55506] (1 species)
  7. Species Rat (Rattus norvegicus) [TaxId:10116] [55507] (1 PDB entry)
  8. Domain d1i1ip_: 1i1i P: [40297]

Details for d1i1ip_

PDB Entry: 1i1i (more details), 2.3 Å

PDB Description: neurolysin (endopeptidase 24.16) crystal structure

SCOP Domain Sequences for d1i1ip_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16) {Rat (Rattus norvegicus)}
mssytaagrnvlrwdlspeqiktrteqliaqtkqvydtvgtialkevtyenclqvladie
vtyivertmldfpqhvssdrevraasteadkklsrfdiemsmredvfqrivhlqetcdle
kikpearryleksikmgkrnglhlsehirneiksmkkrmselcidfnknlneddtslvfs
kaelgalpddfidslektdedkykvtlkyphyfpvmkkccvpetrrkmemafhtrckqen
tailqqllplraqvakllgynthadfvlelntakstsrvaaflddlsqklkplgeaeref
ilslkkkeceergfeydgkinawdlhyymtqteelkysvdqeslkeyfpievvtegllsi
yqellglsfeqvpdahvwnksvslytvkdkatgevlgqfyldlypregkynhaacfglqp
gcllpdgsrmmsvaalvvnfsqpvagrpsllrhdevrtyfhefghvmhqicaqtdfarfs
gtnvetdfvevpsqmlenwvwdvdslrklskhykdghpitdelleklvasrlvntglltl
rqivlskvdqslhtnatldaaseyakycteilgvaatpgtnmpatfghlaggydgqyygy
lwsevfsmdmfhscfkkegimnpevgmkyrnlilkpggsldgmdmlqnflqrepnqkafl
msrgl

SCOP Domain Coordinates for d1i1ip_ are not available.

Timeline for d1i1ip_: