SCOPe 2.08: Domain d7agkc1: 7agk C:1-298

Lineage for d7agkc1 (7agk C:1-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [402932] (3 PDB entries)

8. Domain d7agkc1: 7agk C:1-298 [402950]
   Other proteins in same PDB: d7agkb2, d7agkc2
   automated match to d4xdaa_
   complexed with rah

Details for d7agkc1

PDB Entry: 7agk, 2.97 Å

PDB Description: crystal structure of e. coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp)

PDB Compounds: (C:) Sulfofructose kinase

SCOPe Domain Sequences for d7agkc1:

Sequence; same for both SEQRES and ATOM records:

>d7agkc1 c.72.1.0 (C:1-298) automated matches {Escherichia coli [TaxId: 83333]}
mirvacvgitvmdriyyveglptesgkyvarnytevgggpaataavaaarlgaqvdfigr
vgdddtgnsllaeleswgvntrytkrynqakssqsaimvdtkgeriiinypspdllpdae
wleeidfsqwdvvladvrwhdgakkaftlarqagvmtvldgditpqdiselvalsdhaaf
sepglarltgvkemasalkqaqtltnghvyvtqgsagcdwlenggrqhqpafkvdvvdtt
gagdvfhgalavalatsgdlaesvrfasgvaalkctrpggragipdcdqtrsflslfv

Timeline for d7agkc1:

• d7agkc1 first appeared in SCOPe 2.07