Lineage for d1lmla_ (1lml A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867694Family d.92.1.3: Leishmanolysin [55499] (1 protein)
  6. 867695Protein Leishmanolysin [55500] (1 species)
    the catalytic domain is N-terminal (residues 100-272)
    the rest of structure will be classified in future releases
  7. 867696Species Leishmania major [TaxId:5664] [55501] (1 PDB entry)
  8. 867697Domain d1lmla_: 1lml A: [40295]
    complexed with zn

Details for d1lmla_

PDB Entry: 1lml (more details), 1.86 Å

PDB Description: leishmanolysin
PDB Compounds: (A:) leishmanolysin

SCOP Domain Sequences for d1lmla_:

Sequence, based on SEQRES records: (download)

>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]}
vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
qwpamfcnesedaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvv
pysdgsctqraseahasllpfnvfsdaarcidgafrpkatdgivksyaglcanvqcdtat
rtysvqvhgsndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd

Sequence, based on observed residues (ATOM records): (download)

>d1lmla_ d.92.1.3 (A:) Leishmanolysin {Leishmania major [TaxId: 5664]}
vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
qwpamfcnaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvvpysd
gsctqraseahasllpfnvfsdaarcidgafrpkasyaglcanvqcdtatrtysvqvhgs
ndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd

SCOP Domain Coordinates for d1lmla_:

Click to download the PDB-style file with coordinates for d1lmla_.
(The format of our PDB-style files is described here.)

Timeline for d1lmla_: