Lineage for d1lml__ (1lml -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34358Family d.92.1.3: Leishmanolysin [55499] (1 protein)
  6. 34359Protein Leishmanolysin [55500] (1 species)
  7. 34360Species Leishmania major [TaxId:5664] [55501] (1 PDB entry)
  8. 34361Domain d1lml__: 1lml - [40295]

Details for d1lml__

PDB Entry: 1lml (more details), 1.86 Å

PDB Description: leishmanolysin

SCOP Domain Sequences for d1lml__:

Sequence, based on SEQRES records: (download)

>d1lml__ d.92.1.3 (-) Leishmanolysin {Leishmania major}
vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
qwpamfcnesedaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvv
pysdgsctqraseahasllpfnvfsdaarcidgafrpkatdgivksyaglcanvqcdtat
rtysvqvhgsndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd

Sequence, based on observed residues (ATOM records): (download)

>d1lml__ d.92.1.3 (-) Leishmanolysin {Leishmania major}
vvrdvnwgalriavstedltdpayhcarvgqhvkdhagaivtctaediltnekrdilvkh
lipqavqlhterlkvqqvqgkwkvtdmvgdicgdfkvpqahitegfsntdfvmyvasvps
eegvlawattcqtfsdghpavgvinipaaniasrydqlvtrvvthemahalgfsgpffed
arivanvpnvrgknfdvpvinsstavakareqygcdtleylevedqggagsagshikmrn
aqdelmapaaaagyytaltmaifqdlgfyqadfskaevmpwgqnagcafltnkcmeqsvt
qwpamfcnaircptsrlslgacgvtrhpglppywqyftdpslagvsafmdycpvvvpysd
gsctqraseahasllpfnvfsdaarcidgafrpkasyaglcanvqcdtatrtysvqvhgs
ndytnctpglrvelstvsnafegggyitcppyvevcqgnvqaakd

SCOP Domain Coordinates for d1lml__:

Click to download the PDB-style file with coordinates for d1lml__.
(The format of our PDB-style files is described here.)

Timeline for d1lml__: