Lineage for d1bqba2 (1bqb A:1-154)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.2: Thermolysin-like [55490] (4 proteins) 
Protein Aureolysin [55497] (1 species) Species Staphylococcus aureus [TaxId:1280] [55498] (1 PDB entry) 
Domain d1bqba2: 1bqb A:1-154 [40294]
Other proteins in same PDB: d1bqba1
Details for d1bqba2
PDB Entry: 1bqb (more details), 1.72 Å
PDB Description: aureolysin, staphylococcus aureus metalloproteinase
SCOP Domain Sequences for d1bqba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqba2 d.92.1.2 (A:1-154) Aureolysin {Staphylococcus aureus}
aaatgtgkgvlgdtkdininsidggfsledlthqgklsaynfndqtgqatlitnedenfv
kddqragvdanyyakqtydyykntfgresydnhgspivslthvnhyggqdnrnnaawigd
kmiygdgdgrtftnlsgandvvaheithgvtqqt
SCOP Domain Coordinates for d1bqba2:
Click to download the PDB-style file with coordinates for d1bqba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bqba2:
- d1bqba2 does not appear in SCOP 1.57
View in 3D
