SCOPe 2.08: Domain d6zclc_: 6zcl C:

Lineage for d6zclc_ (6zcl C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Coxsackievirus b3 (strain nancy) [TaxId:103903] [402851] (1 PDB entry)

8. Domain d6zclc_: 6zcl C: [402852]
   automated match to d1cov3_
   complexed with fhk, myr

Details for d6zclc_

PDB Entry: 6zcl, 2.8 Å

PDB Description: coxsackievirus b3 in complex with capsid binder compound 17

PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d6zclc_:

Sequence; same for both SEQRES and ATOM records:

>d6zclc_ b.121.4.1 (C:) automated matches {Coxsackievirus b3 (strain nancy) [TaxId: 103903]}
glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
cgsamatgkfllaysppgagaptkrvdamlgthviwdvglqsscvlcipwisqthyrfva
sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqqnff

Timeline for d6zclc_:

• d6zclc_ first appeared in SCOPe 2.07