SCOPe 2.08: Domain d6ygqc1: 6ygq C:15-133

Lineage for d6ygqc1 (6ygq C:15-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Enterobacter cloacae [TaxId:550] [402816] (1 PDB entry)

8. Domain d6ygqc1: 6ygq C:15-133 [402838]
   Other proteins in same PDB: d6ygqa2, d6ygqb2, d6ygqc2
   automated match to d5ofxa_
   complexed with ca

Details for d6ygqc1

PDB Entry: 6ygq, 1.9 Å

PDB Description: ecla n-terminal domain; plla-like lectin

PDB Compounds: (C:) PA-I galactophilic lectin

SCOPe Domain Sequences for d6ygqc1:

Sequence; same for both SEQRES and ATOM records:

>d6ygqc1 b.18.1.0 (C:15-133) automated matches {Enterobacter cloacae [TaxId: 550]}
senliwsgkvdaknaegtntgvalkageiitilasgwarngsenfaltapqgripreget
ltlrnpslqarlgnenypvgnhkyrwsvpaegtltlffadgkdqykdnagefsvevyre

Timeline for d6ygqc1:

• d6ygqc1 first appeared in SCOPe 2.07