Lineage for d6w6gd1 (6w6g D:548-845)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480604Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries)
  8. 2480629Domain d6w6gd1: 6w6g D:548-845 [402813]
    automated match to d1qvra3
    complexed with adp, ags

Details for d6w6gd1

PDB Entry: 6w6g (more details), 3.1 Å

PDB Description: the mycobacterium tuberculosis clpb disaggregase hexamer structure in conformation i in the presence of dnak chaperone and a model substrate
PDB Compounds: (D:) Chaperone protein ClpB

SCOPe Domain Sequences for d6w6gd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w6gd1 c.37.1.0 (D:548-845) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ipagrllegetakllrmedelgkrvigqkaavtavsdavrrsragvsdpnrptgafmflg
ptgvgktelakaladflfdderamvridmseygekhtvarligappgyvgyeaggqltea
vrrrpytvvlfdeiekahpdvfdvllqvldegrltdghgrtvdfrntililtsnlgsggs
aeqvlaavratfkpefinrlddvlifeglnpeelvrivdiqlaqlgkrlaqrrlqlqvsl
pakrwlaqrgfdpvygarplrrlvqqaigdqlakmllagqvhdgdtvpvnvspdadsl

SCOPe Domain Coordinates for d6w6gd1:

Click to download the PDB-style file with coordinates for d6w6gd1.
(The format of our PDB-style files is described here.)

Timeline for d6w6gd1: