SCOPe 2.07: Domain d6ybhb_: 6ybh B:

Lineage for d6ybhb_ (6ybh B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries)

8. Domain d6ybhb_: 6ybh B: [402805]
   automated match to d1j90a_
   complexed with 4pc, gol, so4

Details for d6ybhb_

PDB Entry: 6ybh, 2.4 Å

PDB Description: deoxyribonucleoside kinase

PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d6ybhb_:

Sequence; same for both SEQRES and ATOM records:

>d6ybhb_ c.37.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mkyaegtrpftiliegnigsgkttylnhfekykddiclltepvekwrnvngvnllelmyk
dpkkwampfvsyvtltmlqmhtqptnkkvkimersifsarycfvenmrrngwleqgmynt
leewykfieesihiqadliiylrtspevayerirkrgrpeeknvpleylqqlhqlhedwl
ihqrrpqsckvlvldadlnlenigteyqrsessif

Timeline for d6ybhb_:

• d6ybhb_ is new in SCOPe 2.07-stable
  
• d6ybhb_ appears in the current release, SCOPe 2.08