Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
Protein automated matches [254664] (2 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries) |
Domain d6wvwf_: 6wvw F: [402746] Other proteins in same PDB: d6wvwc_, d6wvwd_, d6wvwe2, d6wvwg_, d6wvwh_ automated match to d1sfcf_ complexed with ca, mpd |
PDB Entry: 6wvw (more details), 2.11 Å
SCOPe Domain Sequences for d6wvwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wvwf_ h.1.15.1 (F:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd tkkavk
Timeline for d6wvwf_: