Lineage for d6wvwf_ (6wvw F:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644809Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 2644810Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 2644912Protein automated matches [254664] (2 species)
    not a true protein
  7. 2644917Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries)
  8. 2644923Domain d6wvwf_: 6wvw F: [402746]
    Other proteins in same PDB: d6wvwc_, d6wvwd_, d6wvwe2, d6wvwg_, d6wvwh_
    automated match to d1sfcf_
    complexed with ca, mpd

Details for d6wvwf_

PDB Entry: 6wvw (more details), 2.11 Å

PDB Description: crystal structure of the r59p-snap25 containing snare complex
PDB Compounds: (F:) syntaxin-1a

SCOPe Domain Sequences for d6wvwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wvwf_ h.1.15.1 (F:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
alseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd
tkkavk

SCOPe Domain Coordinates for d6wvwf_:

Click to download the PDB-style file with coordinates for d6wvwf_.
(The format of our PDB-style files is described here.)

Timeline for d6wvwf_: