Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries) |
Domain d6xhfa_: 6xhf A: [402745] automated match to d1kf3a_ protein/RNA complex; complexed with cl, v2s |
PDB Entry: 6xhf (more details), 1.45 Å
SCOPe Domain Sequences for d6xhfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xhfa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]} ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf dasv
Timeline for d6xhfa_: