Lineage for d6wu8b2 (6wu8 B:111-218)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965774Domain d6wu8b2: 6wu8 B:111-218 [402737]
    Other proteins in same PDB: d6wu8a3, d6wu8b3
    automated match to d3ps5a2
    complexed with u9y

Details for d6wu8b2

PDB Entry: 6wu8 (more details), 2.4 Å

PDB Description: structure of human shp2 in complex with inhibitor iacs-13909
PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6wu8b2:

Sequence, based on SEQRES records: (download)

>d6wu8b2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv
mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

Sequence, based on observed residues (ATOM records): (download)

>d6wu8b2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdddgkskvthvmircq
elkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt

SCOPe Domain Coordinates for d6wu8b2:

Click to download the PDB-style file with coordinates for d6wu8b2.
(The format of our PDB-style files is described here.)

Timeline for d6wu8b2: