Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d6wu8b2: 6wu8 B:111-218 [402737] Other proteins in same PDB: d6wu8a3, d6wu8b3 automated match to d3ps5a2 complexed with u9y |
PDB Entry: 6wu8 (more details), 2.4 Å
SCOPe Domain Sequences for d6wu8b2:
Sequence, based on SEQRES records: (download)
>d6wu8b2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthv mircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt
>d6wu8b2 d.93.1.0 (B:111-218) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgdddgkskvthvmircq elkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnt
Timeline for d6wu8b2: