SCOPe 2.08: Domain d6ud0c_: 6ud0 C:

Lineage for d6ud0c_ (6ud0 C:)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
4. Superfamily d.20.1: UBC-like [54495] (5 families)
5. Family d.20.1.2: UEV domain [75383] (3 proteins)
6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
8. Domain d6ud0c_: 6ud0 C: [402683]
   Other proteins in same PDB: d6ud0a_, d6ud0b_
   automated match to d5vkga_

Details for d6ud0c_

PDB Entry: 6ud0

PDB Description: solution-state nmr structural ensemble of human tsg101 uev in complex with k63-linked diubiquitin

PDB Compounds: (C:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d6ud0c_:

Sequence; same for both SEQRES and ATOM records:

>d6ud0c_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfs

SCOPe Domain Coordinates for d6ud0c_ are not available.

Timeline for d6ud0c_:

• d6ud0c_ first appeared in SCOPe 2.07