Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries) |
Domain d6wpca3: 6wpc A:484-640 [402682] Other proteins in same PDB: d6wpca1, d6wpca2, d6wpcb1, d6wpcb2, d6wpcc1, d6wpcc2, d6wpcd1, d6wpcd2 automated match to d1ciya1 |
PDB Entry: 6wpc (more details), 2.99 Å
SCOPe Domain Sequences for d6wpca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wpca3 b.18.1.0 (A:484-640) automated matches {Bacillus thuringiensis [TaxId: 1428]} nniiasdsinqiplvkgfrvwggtsvitgpgftggdilrrntfgdfvslqvninspitqr yrlrfryassrdarvivltgaastgvggqvsvnmplqktmeigenltsrtfrytdfsnpf sfranpdiigiseqplfgagsissgelyidkieiila
Timeline for d6wpca3: