Lineage for d6wpca3 (6wpc A:484-640)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775002Species Bacillus thuringiensis [TaxId:1428] [255814] (7 PDB entries)
  8. 2775009Domain d6wpca3: 6wpc A:484-640 [402682]
    Other proteins in same PDB: d6wpca1, d6wpca2, d6wpcb1, d6wpcb2, d6wpcc1, d6wpcc2, d6wpcd1, d6wpcd2
    automated match to d1ciya1

Details for d6wpca3

PDB Entry: 6wpc (more details), 2.99 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.2 tryptic core variant
PDB Compounds: (A:) Cry1A.2

SCOPe Domain Sequences for d6wpca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wpca3 b.18.1.0 (A:484-640) automated matches {Bacillus thuringiensis [TaxId: 1428]}
nniiasdsinqiplvkgfrvwggtsvitgpgftggdilrrntfgdfvslqvninspitqr
yrlrfryassrdarvivltgaastgvggqvsvnmplqktmeigenltsrtfrytdfsnpf
sfranpdiigiseqplfgagsissgelyidkieiila

SCOPe Domain Coordinates for d6wpca3:

Click to download the PDB-style file with coordinates for d6wpca3.
(The format of our PDB-style files is described here.)

Timeline for d6wpca3: