Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries) |
Domain d6w6gb2: 6w6g B:548-845 [402653] automated match to d1qvra3 complexed with adp, ags |
PDB Entry: 6w6g (more details), 3.1 Å
SCOPe Domain Sequences for d6w6gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w6gb2 c.37.1.0 (B:548-845) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ipagrllegetakllrmedelgkrvigqkaavtavsdavrrsragvsdpnrptgafmflg ptgvgktelakaladflfdderamvridmseygekhtvarligappgyvgyeaggqltea vrrrpytvvlfdeiekahpdvfdvllqvldegrltdghgrtvdfrntililtsnlgsggs aeqvlaavratfkpefinrlddvlifeglnpeelvrivdiqlaqlgkrlaqrrlqlqvsl pakrwlaqrgfdpvygarplrrlvqqaigdqlakmllagqvhdgdtvpvnvspdadsl
Timeline for d6w6gb2: