SCOPe 2.08: Domain d6w6gb2: 6w6g B:548-845

Lineage for d6w6gb2 (6w6g B:548-845)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189039] (16 PDB entries)

8. Domain d6w6gb2: 6w6g B:548-845 [402653]
   automated match to d1qvra3
   complexed with adp, ags

Details for d6w6gb2

PDB Entry: 6w6g, 3.1 Å

PDB Description: the mycobacterium tuberculosis clpb disaggregase hexamer structure in conformation i in the presence of dnak chaperone and a model substrate

PDB Compounds: (B:) Chaperone protein ClpB

SCOPe Domain Sequences for d6w6gb2:

Sequence; same for both SEQRES and ATOM records:

>d6w6gb2 c.37.1.0 (B:548-845) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ipagrllegetakllrmedelgkrvigqkaavtavsdavrrsragvsdpnrptgafmflg
ptgvgktelakaladflfdderamvridmseygekhtvarligappgyvgyeaggqltea
vrrrpytvvlfdeiekahpdvfdvllqvldegrltdghgrtvdfrntililtsnlgsggs
aeqvlaavratfkpefinrlddvlifeglnpeelvrivdiqlaqlgkrlaqrrlqlqvsl
pakrwlaqrgfdpvygarplrrlvqqaigdqlakmllagqvhdgdtvpvnvspdadsl

Timeline for d6w6gb2:

• d6w6gb2 first appeared in SCOPe 2.07