SCOPe 2.07: Domain d7bu4a_: 7bu4 A:

Lineage for d7bu4a_ (7bu4 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)

8. Domain d7bu4a_: 7bu4 A: [402618]
   automated match to d3wara_
   complexed with y49

Details for d7bu4a_

PDB Entry: 7bu4, 1.7 Å

PDB Description: crystal structure of ck2a1 complexed with ky49

PDB Compounds: (A:) Casein Kinase 2 subunit alpha

SCOPe Domain Sequences for d7bu4a_:

Sequence; same for both SEQRES and ATOM records:

>d7bu4a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

Timeline for d7bu4a_:

• d7bu4a_ is new in SCOPe 2.07-stable
  
• d7bu4a_ appears in the current release, SCOPe 2.08