| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) ![]() automatically mapped to Pfam PF09408 |
| Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
| Protein Spike protein S1 [143589] (4 species) |
| Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries) |
| Domain d7nxcb_: 7nxc B: [402608] Other proteins in same PDB: d7nxca_ automated match to d2dd8s1 complexed with nag |
PDB Entry: 7nxc (more details), 3.14 Å
SCOPe Domain Sequences for d7nxcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nxcb_ d.318.1.1 (B:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf
tnvyadsfvirgdevrqiapgqtgtiadynyklpddftgcviawnsnnldskvggnynyl
yrlfrksnlkpferdisteiyqagstpcngvkgfncyfplqsygfqptygvgyqpyrvvv
lsfellhapatvcgk
Timeline for d7nxcb_: